Lineage for d1ffvd2 (1ffv D:2-81)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408093Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 408186Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (10 proteins)
  6. 408196Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 408197Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)
  8. 408199Domain d1ffvd2: 1ffv D:2-81 [37701]
    Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2
    complexed with aro, csz, fad, fes, pcd

Details for d1ffvd2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvd2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava}
akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
cthlavqcdgsevltvegla

SCOP Domain Coordinates for d1ffvd2:

Click to download the PDB-style file with coordinates for d1ffvd2.
(The format of our PDB-style files is described here.)

Timeline for d1ffvd2: