![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species) |
![]() | Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries) |
![]() | Domain d1ffva2: 1ffv A:3-81 [37700] Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2 complexed with fad, fes, pcd |
PDB Entry: 1ffv (more details), 2.25 Å
SCOPe Domain Sequences for d1ffva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc thlavqcdgsevltvegla
Timeline for d1ffva2: