SCOPe 2.05: Domain d1fiqa2: 1fiq A:2-92

Lineage for d1fiqa2 (1fiq A:2-92)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Xanthine oxidase, N-terminal domain [54318] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
   Uniprot P80457

8. Domain d1fiqa2: 1fiq A:2-92 [37697]
   Other proteins in same PDB: d1fiqa1, d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2
   complexed with fad, fes, gol, mos, mte, sal

Details for d1fiqa2

PDB Entry: 1fiq, 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

PDB Compounds: (A:) xanthine oxidase

SCOPe Domain Sequences for d1fiqa2:

Sequence; same for both SEQRES and ATOM records:

>d1fiqa2 d.15.4.2 (A:2-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

Timeline for d1fiqa2:

• d1fiqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1fiqa2 appears in SCOPe 2.04
  
• d1fiqa2 appears in SCOPe 2.06
  
• d1fiqa2 appears in the current release, SCOPe 2.08