Lineage for d1fiqa2 (1fiq A:2-92)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77994Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)
  6. 78030Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 78031Species Cow (Bos taurus) [TaxId:9913] [54319] (2 PDB entries)
  8. 78034Domain d1fiqa2: 1fiq A:2-92 [37697]
    Other proteins in same PDB: d1fiqa1, d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2

Details for d1fiqa2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

SCOP Domain Sequences for d1fiqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqa2 d.15.4.2 (A:2-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus)}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOP Domain Coordinates for d1fiqa2:

Click to download the PDB-style file with coordinates for d1fiqa2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqa2: