Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins) |
Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [54319] (6 PDB entries) Uniprot P80457 |
Domain d1fo4b2: 1fo4 B:3-92 [37696] Other proteins in same PDB: d1fo4a1, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6 complexed with ca, fad, fes, gol, mos, mte, sal |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOP Domain Sequences for d1fo4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4b2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq dkiihfsanaclapictlhhvavttvegig
Timeline for d1fo4b2: