SCOP 1.75: Domain d1fo4b2: 1fo4 B:3-92

Lineage for d1fo4b2 (1fo4 B:3-92)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Xanthine oxidase, N-terminal domain [54318] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54319] (6 PDB entries)
   Uniprot P80457

8. Domain d1fo4b2: 1fo4 B:3-92 [37696]
   Other proteins in same PDB: d1fo4a1, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6
   complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4b2

PDB Entry: 1fo4, 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

PDB Compounds: (B:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1fo4b2:

Sequence; same for both SEQRES and ATOM records:

>d1fo4b2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

Timeline for d1fo4b2:

• d1fo4b2 first appeared (with stable ids) in SCOP 1.55
  
• d1fo4b2 appears in SCOP 1.73
  
• d1fo4b2 appears in SCOPe 2.01
  
• d1fo4b2 appears in the current release, SCOPe 2.08