![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins) |
![]() | Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54319] (2 PDB entries) |
![]() | Domain d1fo4b2: 1fo4 B:3-92 [37696] Other proteins in same PDB: d1fo4a1, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6 |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOP Domain Sequences for d1fo4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4b2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus)} adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq dkiihfsanaclapictlhhvavttvegig
Timeline for d1fo4b2: