Lineage for d6ueed_ (6uee D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814330Species Pseudomonas aeruginosa [TaxId:381754] [276926] (6 PDB entries)
  8. 2814346Domain d6ueed_: 6uee D: [376951]
    automated match to d5depa_
    complexed with gol, q5m

Details for d6ueed_

PDB Entry: 6uee (more details), 2.1 Å

PDB Description: pseudomonas aeruginosa lpxa complex structure with ligand
PDB Compounds: (D:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d6ueed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ueed_ b.81.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
slidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqf
ssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahigh
dsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayv
tvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpe
vavfrdsiqsatrgitr

SCOPe Domain Coordinates for d6ueed_:

Click to download the PDB-style file with coordinates for d6ueed_.
(The format of our PDB-style files is described here.)

Timeline for d6ueed_: