Lineage for d1fo4a2 (1fo4 A:3-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541241Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 2541242Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 2541259Domain d1fo4a2: 1fo4 A:3-92 [37695]
    Other proteins in same PDB: d1fo4a1, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4a2

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d1fo4a2:

Click to download the PDB-style file with coordinates for d1fo4a2.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a2: