SCOPe 2.06: Domain d1dgja2: 1dgj A:1-80

Lineage for d1dgja2 (1dgj A:1-80)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [54317] (1 PDB entry)

8. Domain d1dgja2: 1dgj A:1-80 [37694]
   Other proteins in same PDB: d1dgja1, d1dgja3, d1dgja4
   complexed with 2mo, fes, mcn

Details for d1dgja2

PDB Entry: 1dgj, 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1dgja2:

Sequence; same for both SEQRES and ATOM records:

>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
iikmsrvaenasvttlegig

Timeline for d1dgja2:

• d1dgja2 first appeared (with stable ids) in SCOP 1.55
  
• d1dgja2 appears in SCOPe 2.05
  
• d1dgja2 appears in SCOPe 2.07
  
• d1dgja2 appears in the current release, SCOPe 2.08