Lineage for d1dgja2 (1dgj A:1-80)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131113Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins)
  6. 131114Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 131115Species Desulfovibrio desulfuricans [TaxId:876] [54317] (1 PDB entry)
  8. 131116Domain d1dgja2: 1dgj A:1-80 [37694]
    Other proteins in same PDB: d1dgja1, d1dgja3, d1dgja4

Details for d1dgja2

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d1dgja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans}
metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
iikmsrvaenasvttlegig

SCOP Domain Coordinates for d1dgja2:

Click to download the PDB-style file with coordinates for d1dgja2.
(The format of our PDB-style files is described here.)

Timeline for d1dgja2: