Lineage for d6rpsa_ (6rps A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2421992Species Human (Homo sapiens), isozyme XII [TaxId:9606] [63844] (26 PDB entries)
  8. 2422087Domain d6rpsa_: 6rps A: [376935]
    Other proteins in same PDB: d6rpsl1, d6rpsl2, d6rpsm1, d6rpsm2
    automated match to d4ht2a_
    complexed with act, cd, cl, so4, zn

Details for d6rpsa_

PDB Entry: 6rps (more details), 2.79 Å

PDB Description: x-ray crystal structure of carbonic anhydrase xii complexed with a theranostic monoclonal antibody fragment
PDB Compounds: (A:) Carbonic anhydrase 12

SCOPe Domain Sequences for d6rpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rpsa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]}
mkwtyfgpdgenswskkypscggllqspidlhsdilqydasltplefqgynlsankqfll
tnnghsvklnlpsdmhiqglqsrysatqlhlhwgnpndphgsehtvsgqhfaaelhivhy
nsdlypdastasnkseglavlavliemgsfnpsydkifshlqhvkykgqeafvpgfniee
llpertaeyyryrgslttppcnptvlwtvfrnpvqisqeqllaletalycthmddpspre
minnfrqvqkfderlvytsfsq

SCOPe Domain Coordinates for d6rpsa_:

Click to download the PDB-style file with coordinates for d6rpsa_.
(The format of our PDB-style files is described here.)

Timeline for d6rpsa_:

  • d6rpsa_ is new in SCOPe 2.07-stable
  • d6rpsa_ appears in the current release, SCOPe 2.08, called d6rpsa1