Lineage for d1c4aa2 (1c4a A:1-126)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598835Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 598929Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)
  6. 598963Protein Fe-only hydrogenase, N-terminal domain [54313] (1 species)
  7. 598964Species Clostridium pasteurianum [TaxId:1501] [54314] (3 PDB entries)
  8. 598967Domain d1c4aa2: 1c4a A:1-126 [37692]
    Other proteins in same PDB: d1c4aa1, d1c4aa3

Details for d1c4aa2

PDB Entry: 1c4a (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum

SCOP Domain Sequences for d1c4aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4aa2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

SCOP Domain Coordinates for d1c4aa2:

Click to download the PDB-style file with coordinates for d1c4aa2.
(The format of our PDB-style files is described here.)

Timeline for d1c4aa2: