Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:381754] [276926] (6 PDB entries) |
Domain d6uegc_: 6ueg C: [376918] automated match to d5depa_ complexed with ca, q5g |
PDB Entry: 6ueg (more details), 2 Å
SCOPe Domain Sequences for d6uegc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uegc_ b.81.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]} lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev avfrdsiqsatrgitr
Timeline for d6uegc_: