Lineage for d6sdzk_ (6sdz K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2768980Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
    Uniprot P02766 31-143
  8. 2769663Domain d6sdzk_: 6sdz K: [376912]
    automated match to d1eta1_

Details for d6sdzk_

PDB Entry: 6sdz (more details), 2.97 Å

PDB Description: transthyritin derived amyloid fibril from patient with hereditary v30m attr amyloidosis
PDB Compounds: (K:) Transthyretin

SCOPe Domain Sequences for d6sdzk_:

Sequence, based on SEQRES records: (download)

>d6sdzk_ b.3.4.1 (K:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records): (download)

>d6sdzk_ b.3.4.1 (K:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvamhvfrkgltteeefvegiykveidtksywkalgispfheha
evvftandsgprrytiaallspysysttavvt

SCOPe Domain Coordinates for d6sdzk_:

Click to download the PDB-style file with coordinates for d6sdzk_.
(The format of our PDB-style files is described here.)

Timeline for d6sdzk_: