Lineage for d6pd6a2 (6pd6 A:872-1039)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 3076775Species Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId:380835] [376837] (3 PDB entries)
  8. 3076788Domain d6pd6a2: 6pd6 A:872-1039 [376850]
    Other proteins in same PDB: d6pd6a1, d6pd6a3
    automated match to d1ha0a2
    complexed with gol, nag, so4

Details for d6pd6a2

PDB Entry: 6pd6 (more details), 2.87 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin at ph 7.0
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6pd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pd6a2 h.3.1.0 (A:872-1039) automated matches {Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId: 380835]}
aiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfe
avgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrl
qlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree

SCOPe Domain Coordinates for d6pd6a2:

Click to download the PDB-style file with coordinates for d6pd6a2.
(The format of our PDB-style files is described here.)

Timeline for d6pd6a2: