Lineage for d6pcxa2 (6pcx A:871-1038)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646468Species Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId:380863] [376846] (1 PDB entry)
  8. 2646469Domain d6pcxa2: 6pcx A:871-1038 [376847]
    Other proteins in same PDB: d6pcxa1, d6pcxa3
    automated match to d1ha0a2
    complexed with gol, nag, so4

Details for d6pcxa2

PDB Entry: 6pcx (more details), 2.11 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin at ph 6.0
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6pcxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcxa2 h.3.1.0 (A:871-1038) automated matches {Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId: 380863]}
aiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfe
avgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrl
qlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree

SCOPe Domain Coordinates for d6pcxa2:

Click to download the PDB-style file with coordinates for d6pcxa2.
(The format of our PDB-style files is described here.)

Timeline for d6pcxa2: