Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId:380863] [376846] (1 PDB entry) |
Domain d6pcxa2: 6pcx A:871-1038 [376847] Other proteins in same PDB: d6pcxa1, d6pcxa3 automated match to d1ha0a2 complexed with gol, nag, so4 |
PDB Entry: 6pcx (more details), 2.11 Å
SCOPe Domain Sequences for d6pcxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pcxa2 h.3.1.0 (A:871-1038) automated matches {Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId: 380863]} aiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfe avgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrl qlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree
Timeline for d6pcxa2: