Lineage for d6pcxa1 (6pcx A:11-330)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386022Species Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId:380863] [376844] (1 PDB entry)
  8. 2386023Domain d6pcxa1: 6pcx A:11-330 [376845]
    Other proteins in same PDB: d6pcxa2, d6pcxa3
    automated match to d4we4a_
    complexed with gol, nag, so4

Details for d6pcxa1

PDB Entry: 6pcx (more details), 2.11 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin at ph 6.0
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6pcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcxa1 b.19.1.0 (A:11-330) automated matches {Influenza a virus (a/mallard/vietnam/3/2003(h5n1)) [TaxId: 380863]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d6pcxa1:

Click to download the PDB-style file with coordinates for d6pcxa1.
(The format of our PDB-style files is described here.)

Timeline for d6pcxa1: