Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId:380835] [376835] (4 PDB entries) |
Domain d6pd3a1: 6pd3 A:11-330 [376836] Other proteins in same PDB: d6pd3a2, d6pd3a3 automated match to d4we4a_ complexed with gol, nag, so4 |
PDB Entry: 6pd3 (more details), 2.3 Å
SCOPe Domain Sequences for d6pd3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pd3a1 b.19.1.0 (A:11-330) automated matches {Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId: 380835]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrns
Timeline for d6pd3a1: