Lineage for d6mv6a1 (6mv6 A:3-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535825Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2535826Protein automated matches [190767] (7 species)
    not a true protein
  7. 2535835Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)
  8. 2535838Domain d6mv6a1: 6mv6 A:3-127 [376821]
    Other proteins in same PDB: d6mv6a2
    automated match to d2e0oa_
    complexed with po4

Details for d6mv6a1

PDB Entry: 6mv6 (more details), 1.5 Å

PDB Description: crystal structure of rnase 6
PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d6mv6a1:

Sequence, based on SEQRES records: (download)

>d6mv6a1 d.5.1.0 (A:3-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsivc
knrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvpvh
ldsil

Sequence, based on observed residues (ATOM records): (download)

>d6mv6a1 d.5.1.0 (A:3-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsivc
knrrhnchqsskpvnmtdcrltypqcrysaaaqykffivacdppqksdppyklvpvhlds
il

SCOPe Domain Coordinates for d6mv6a1:

Click to download the PDB-style file with coordinates for d6mv6a1.
(The format of our PDB-style files is described here.)

Timeline for d6mv6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mv6a2