Lineage for d1pdxa_ (1pdx A:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) Protein 2Fe-2S ferredoxin [54294] (16 species) 
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (3 PDB entries) 
Domain d1pdxa_: 1pdx A: [37682]
complexed with fes
Details for d1pdxa_
PDB Entry: 1pdx (more details)
PDB Description: putidaredoxin
SCOP Domain Sequences for d1pdxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdxa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
SCOP Domain Coordinates for d1pdxa_:
Click to download the PDB-style file with coordinates for d1pdxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdxa_:
- d1pdxa_ first appeared (with stable ids) in SCOP 1.55
- d1pdxa_ appears in SCOP 1.61
- d1pdxa_ appears in SCOP 1.65
- d1pdxa_ appears in the current release, SCOPe 2.08
View in 3D