Lineage for d1gpx__ (1gpx -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) Protein 2Fe-2S ferredoxin [54294] (16 species) 
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (3 PDB entries) 
Domain d1gpx__: 1gpx - [37681]
Details for d1gpx__
PDB Entry: 1gpx (more details)
PDB Description: c85s gapdx, nmr, 20 structures
SCOP Domain Sequences for d1gpx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpx__ d.15.4.1 (-) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlscqiimtpeldgivvdvpdrqw
SCOP Domain Coordinates for d1gpx__:
Click to download the PDB-style file with coordinates for d1gpx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gpx__:
- d1gpx__ first appeared (with stable ids) in SCOP 1.55
- d1gpx__ appears in SCOP 1.59
- d1gpx__ appears in SCOP 1.63
- d1gpx__ appears in the current release, SCOPe 2.08, called d1gpxa_
View in 3D