Lineage for d1gpx__ (1gpx -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30558Protein Putidaredoxin [54306] (1 species)
  7. 30559Species Pseudomonas putida [TaxId:303] [54307] (3 PDB entries)
  8. 30561Domain d1gpx__: 1gpx - [37681]

Details for d1gpx__

PDB Entry: 1gpx (more details)

PDB Description: c85s gapdx, nmr, 20 structures

SCOP Domain Sequences for d1gpx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpx__ d.15.4.1 (-) Putidaredoxin {Pseudomonas putida}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOP Domain Coordinates for d1gpx__:

Click to download the PDB-style file with coordinates for d1gpx__.
(The format of our PDB-style files is described here.)

Timeline for d1gpx__: