Lineage for d1gpxa_ (1gpx A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159799Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2159800Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2159849Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)
  8. 2159884Domain d1gpxa_: 1gpx A: [37681]
    complexed with ga

Details for d1gpxa_

PDB Entry: 1gpx (more details)

PDB Description: c85s gapdx, nmr, 20 structures
PDB Compounds: (A:) putidaredoxin

SCOPe Domain Sequences for d1gpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpxa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1gpxa_:

Click to download the PDB-style file with coordinates for d1gpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1gpxa_: