Lineage for d6l56m_ (6l56 M:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705173Species Tegillarca granosa [TaxId:220873] [376376] (3 PDB entries)
  8. 2705198Domain d6l56m_: 6l56 M: [376791]
    automated match to d5wpna_
    complexed with fe, fe2, na

Details for d6l56m_

PDB Entry: 6l56 (more details), 1.85 Å

PDB Description: fe(ii) loaded tegillarca granosa ferritin
PDB Compounds: (M:) Ferritin

SCOPe Domain Sequences for d6l56m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l56m_ a.25.1.0 (M:) automated matches {Tegillarca granosa [TaxId: 220873]}
qtqprqnfhveseaginkqinmelyasyvyqsmymyfdrddvalpsfakyfkhnseeere
haeklmkyqnkrggrivlqdiqkpdldewgspleamqttlaleksvnqalldlhkiadkh
gdaqmmdflegeylkeqvdaieeisdhitnlkrvgtglgeymydketms

SCOPe Domain Coordinates for d6l56m_:

Click to download the PDB-style file with coordinates for d6l56m_.
(The format of our PDB-style files is described here.)

Timeline for d6l56m_: