SCOPe 2.01: Domain d1gaqb_: 1gaq B:

Lineage for d1gaqb_ (1gaq B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (1 PDB entry)

8. Domain d1gaqb_: 1gaq B: [37679]
   Other proteins in same PDB: d1gaqa1, d1gaqa2, d1gaqc1, d1gaqc2
   complexed with fad, fes

Details for d1gaqb_

PDB Entry: 1gaq, 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1gaqb_:

Sequence; same for both SEQRES and ATOM records:

>d1gaqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeeltga

Timeline for d1gaqb_:

• d1gaqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gaqb_ appears in SCOP 1.75
  
• d1gaqb_ appears in SCOPe 2.02
  
• d1gaqb_ appears in the current release, SCOPe 2.08