| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
| Protein 2Fe-2S ferredoxin [54294] (16 species) |
| Species Maize (Zea mays) [TaxId:4577] [54305] (1 PDB entry) |
| Domain d1gaqb_: 1gaq B: [37679] Other proteins in same PDB: d1gaqa1, d1gaqa2, d1gaqc1, d1gaqc2 complexed with fad, fes |
PDB Entry: 1gaq (more details), 2.59 Å
SCOP Domain Sequences for d1gaqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays)}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeeltga
Timeline for d1gaqb_:
View in 3DDomains from other chains: (mouse over for more information) d1gaqa1, d1gaqa2, d1gaqc1, d1gaqc2 |