Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries) |
Domain d6mv7a1: 6mv7 A:1-127 [376782] Other proteins in same PDB: d6mv7a2 automated match to d4x09a_ complexed with amp |
PDB Entry: 6mv7 (more details), 2.59 Å
SCOPe Domain Sequences for d6mv7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mv7a1 d.5.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]} wpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsi vcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvp vhldsil
Timeline for d6mv7a1: