Lineage for d6mv7a1 (6mv7 A:1-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928655Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2928656Protein automated matches [190767] (7 species)
    not a true protein
  7. 2928672Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)
  8. 2928677Domain d6mv7a1: 6mv7 A:1-127 [376782]
    Other proteins in same PDB: d6mv7a2
    automated match to d4x09a_
    complexed with amp

Details for d6mv7a1

PDB Entry: 6mv7 (more details), 2.59 Å

PDB Description: crystal structure of rnase 6
PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d6mv7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mv7a1 d.5.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsi
vcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvp
vhldsil

SCOPe Domain Coordinates for d6mv7a1:

Click to download the PDB-style file with coordinates for d6mv7a1.
(The format of our PDB-style files is described here.)

Timeline for d6mv7a1:

  • d6mv7a1 first appeared in SCOPe 2.07, called d6mv7a_

View in 3D
Domains from same chain:
(mouse over for more information)
d6mv7a2