Lineage for d1a70__ (1a70 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30503Protein 2Fe-2S ferredoxin [54294] (11 species)
  7. 30539Species Spinach (Spinacia oleracea) [TaxId:3562] [54304] (1 PDB entry)
  8. 30540Domain d1a70__: 1a70 - [37678]

Details for d1a70__

PDB Entry: 1a70 (more details), 1.7 Å

PDB Description: spinach ferredoxin

SCOP Domain Sequences for d1a70__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a70__ d.15.4.1 (-) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea)}
aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqdd
qsfldddqidegwvltcaaypvsdvtiethkkeelta

SCOP Domain Coordinates for d1a70__:

Click to download the PDB-style file with coordinates for d1a70__.
(The format of our PDB-style files is described here.)

Timeline for d1a70__: