Lineage for d6mq4a_ (6mq4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441484Species Hungateiclostridium cellulolyticum [TaxId:35830] [376762] (1 PDB entry)
  8. 2441485Domain d6mq4a_: 6mq4 A: [376763]
    automated match to d3ndza_
    complexed with peg, pg4, pge

Details for d6mq4a_

PDB Entry: 6mq4 (more details), 1.4 Å

PDB Description: gh5-4 broad specificity endoglucanase from hungateiclostridium cellulolyticum
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d6mq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mq4a_ c.1.8.0 (A:) automated matches {Hungateiclostridium cellulolyticum [TaxId: 35830]}
svaktgmrditaleltkdmrlgwslgntmdayysaasglatetcwgnpkttkamidkvke
agfntvripitwaghfgsapnytidsawlsrveeivnyvldndmyaiinlhheentwlvp
tyanqevataqitklweqiatrfkdysdylifeamneprvvggsaewtggtaenravins
lslaavntiratggnnekrflmvpthaacsltdavndlvipnndskiivslhmyspyyfa
mvsnstptwgtdsdksslsyeldavynkfikngravvigefgsidksnlssrvthaqyya
qeatkrgipvcwwdngyygpgkdnsyallnrssltwyypeivqalvkgsg

SCOPe Domain Coordinates for d6mq4a_:

Click to download the PDB-style file with coordinates for d6mq4a_.
(The format of our PDB-style files is described here.)

Timeline for d6mq4a_: