SCOPe 2.08: Domain d6n47b1: 6n47 B:1-243

Lineage for d6n47b1 (6n47 B:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6n47b1: 6n47 B:1-243 [376751]
   Other proteins in same PDB: d6n47a2, d6n47b2, d6n47c2, d6n47d2, d6n47e_, d6n47f1, d6n47f2, d6n47f3
   automated match to d4drxb1
   complexed with acp, ca, cl, gdp, gtp, kb4, mes, mg

Details for d6n47b1

PDB Entry: 6n47, 2.6 Å

PDB Description: the structure of sb-2-204-tubulin complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6n47b1:

Sequence; same for both SEQRES and ATOM records:

>d6n47b1 c.32.1.1 (B:1-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6n47b1:

• d6n47b1 first appeared in SCOPe 2.07