Lineage for d1frrb_ (1frr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933809Species Equisetum arvense [TaxId:3258] [54301] (2 PDB entries)
    Uniprot P00237 # isoform II
  8. 2933812Domain d1frrb_: 1frr B: [37675]
    complexed with fes

Details for d1frrb_

PDB Entry: 1frr (more details), 1.8 Å

PDB Description: crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution
PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1frrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frrb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]}
ayktvlktpsgeftldvpegttildaaeeagydlpfscragacssclgkvvsgsvdeseg
sflddgqmeegfvltciaipesdlviethkeeelf

SCOPe Domain Coordinates for d1frrb_:

Click to download the PDB-style file with coordinates for d1frrb_.
(The format of our PDB-style files is described here.)

Timeline for d1frrb_: