Lineage for d1frra_ (1frr A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77922Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins)
  6. 77923Protein 2Fe-2S ferredoxin [54294] (12 species)
  7. 77950Species Equisetum arvense [TaxId:3258] [54301] (1 PDB entry)
  8. 77951Domain d1frra_: 1frr A: [37674]

Details for d1frra_

PDB Entry: 1frr (more details), 1.8 Å

PDB Description: crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution

SCOP Domain Sequences for d1frra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense}
ayktvlktpsgeftldvpegttildaaeeagydlpfscragacssclgkvvsgsvdeseg
sflddgqmeegfvltciaipesdlviethkeeelf

SCOP Domain Coordinates for d1frra_:

Click to download the PDB-style file with coordinates for d1frra_.
(The format of our PDB-style files is described here.)

Timeline for d1frra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1frrb_