Lineage for d1awda_ (1awd A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854218Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 854219Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 854225Species Chlorella fusca [TaxId:3073] [54300] (1 PDB entry)
  8. 854226Domain d1awda_: 1awd A: [37673]
    complexed with fes

Details for d1awda_

PDB Entry: 1awd (more details), 1.4 Å

PDB Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca
PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d1awda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]}
ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
flddaqmgkgfvltcvayptsdvtilthqeaaly

SCOP Domain Coordinates for d1awda_:

Click to download the PDB-style file with coordinates for d1awda_.
(The format of our PDB-style files is described here.)

Timeline for d1awda_: