Lineage for d1awda_ (1awd A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503074Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2503075Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2503100Species Chlorella fusca [TaxId:3073] [54300] (1 PDB entry)
  8. 2503101Domain d1awda_: 1awd A: [37673]
    complexed with fes

Details for d1awda_

PDB Entry: 1awd (more details), 1.4 Å

PDB Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1awda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]}
ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
flddaqmgkgfvltcvayptsdvtilthqeaaly

SCOPe Domain Coordinates for d1awda_:

Click to download the PDB-style file with coordinates for d1awda_.
(The format of our PDB-style files is described here.)

Timeline for d1awda_: