Lineage for d6mfia_ (6mfi A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603937Species Simiduia agarivorans [TaxId:1117647] [376718] (1 PDB entry)
  8. 2603938Domain d6mfia_: 6mfi A: [376719]
    automated match to d4awyb_
    complexed with zn

Details for d6mfia_

PDB Entry: 6mfi (more details), 1.84 Å

PDB Description: mim-2 metallo-beta-lactamase
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d6mfia_:

Sequence, based on SEQRES records: (download)

>d6mfia_ d.157.1.0 (A:) automated matches {Simiduia agarivorans [TaxId: 1117647]}
qtavtaehwvdscadwdawdkpgppfrvlgntyyvgtcgiaailitgdaghvlidsgtdr
gavivrdniarlgfslsdvkillhshehidhvggmaslqslsgatlyaspaaaavmrngt
ageddpqagalasfpvarvgglvndgdqialgnlrltayatpghtpgalswqwraceedr
cttlvyadslspvsaegyrfnahpeylqayrlglatladlecdllltphpsasqmrqrls
erqslavpdacrqyatgisarlaqrlasea

Sequence, based on observed residues (ATOM records): (download)

>d6mfia_ d.157.1.0 (A:) automated matches {Simiduia agarivorans [TaxId: 1117647]}
qtavtaehwvdscadwdawdkpgppfrvlgntyyvgtcgiaailitgdaghvlidsgtdr
gavivrdniarlgfslsdvkillhshehidhvggmaslqslsgatlyaspaaaavmrngt
ageddpqagasfpvarvgglvndgdqialgnlrltayatpghtpgalswqwraccttlvy
adslspvsaegyrfnahpeylqayrlglatladlecdllltphpsasqmrqrlserqsla
vpdacrqyatgisarlaqrlasea

SCOPe Domain Coordinates for d6mfia_:

Click to download the PDB-style file with coordinates for d6mfia_.
(The format of our PDB-style files is described here.)

Timeline for d6mfia_: