SCOPe 2.07: Domain d6ir1b_: 6ir1 B:

Lineage for d6ir1b_ (6ir1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camelus bactrianus [TaxId:9837] [371849] (5 PDB entries)

8. Domain d6ir1b_: 6ir1 B: [376711]
   Other proteins in same PDB: d6ir1a_
   automated match to d1mqkh_

Details for d6ir1b_

PDB Entry: 6ir1, 1.92 Å

PDB Description: crystal structure of red fluorescent protein mcherry complexed with the nanobody lam4 at 1.9 angstron resolution

PDB Compounds: (B:) mCherry's nanobody LaM4

SCOPe Domain Sequences for d6ir1b_:

Sequence; same for both SEQRES and ATOM records:

>d6ir1b_ b.1.1.1 (B:) automated matches {Camelus bactrianus [TaxId: 9837]}
aqvqlvesggslvqpggslrlscaasgrfaesssmgwfrqapgkerefvaaiswsggatn
yadsakgrftlsrdntkntvylqmnslkpddtavyycaanlgnyissnqrlygywgqgtq
vtvs

Timeline for d6ir1b_:

• d6ir1b_ is new in SCOPe 2.07-stable
  
• d6ir1b_ appears in the current release, SCOPe 2.08