SCOPe 2.08: Domain d6kg2a2: 6kg2 A:157-333

Lineage for d6kg2a2 (6kg2 A:157-333)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d6kg2a2: 6kg2 A:157-333 [376701]
   Other proteins in same PDB: d6kg2a1, d6kg2b1
   automated match to d5tc4a2
   complexed with d8c, nad, po4

Details for d6kg2a2

PDB Entry: 6kg2, 2.25 Å

PDB Description: human mthfd2 in complex with compound 18

PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d6kg2a2:

Sequence, based on SEQRES records:

>d6kg2a2 c.2.1.0 (A:157-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvlr

Sequence, based on observed residues (ATOM records):

>d6kg2a2 c.2.1.0 (A:157-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhkpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvlr

Timeline for d6kg2a2:

• d6kg2a2 first appeared in SCOPe 2.07