Lineage for d6ir2b_ (6ir2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355154Species Camelus bactrianus [TaxId:9837] [371849] (5 PDB entries)
  8. 2355155Domain d6ir2b_: 6ir2 B: [376693]
    Other proteins in same PDB: d6ir2a_
    automated match to d5bozh_

Details for d6ir2b_

PDB Entry: 6ir2 (more details), 1.39 Å

PDB Description: crystal structure of red fluorescent protein mcherry complexed with the nanobody lam2 at 1.4 angstron resolution
PDB Compounds: (B:) mCherry's nanobody LaM2

SCOPe Domain Sequences for d6ir2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ir2b_ b.1.1.1 (B:) automated matches {Camelus bactrianus [TaxId: 9837]}
vqlvesggglvqaggslrlscatsgftfsdyamgwfrqapgkerefvaaiswsghvtdya
dsvkgrftisrdnvkntvylqmnslkpedtavyscaaaksgtwwyqrsendfgswgqgtq
vtvs

SCOPe Domain Coordinates for d6ir2b_:

Click to download the PDB-style file with coordinates for d6ir2b_.
(The format of our PDB-style files is described here.)

Timeline for d6ir2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ir2a_