Lineage for d1doy__ (1doy -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) Protein 2Fe-2S ferredoxin [54294] (11 species) 
Species Synechocystis sp., pcc 6803 [TaxId:1148] [54298] (2 PDB entries) 
Domain d1doy__: 1doy - [37669]
Details for d1doy__
PDB Entry: 1doy (more details)
PDB Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
SCOP Domain Sequences for d1doy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doy__ d.15.4.1 (-) 2Fe-2S ferredoxin {Synechocystis sp., pcc 6803}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly
SCOP Domain Coordinates for d1doy__:
Click to download the PDB-style file with coordinates for d1doy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1doy__:
- d1doy__ appears in SCOP 1.57
- d1doy__ appears in the current release, SCOPe 2.08, called d1doya_
View in 3D