SCOPe 2.08: Domain d1doya_: 1doy A:

Lineage for d1doya_ (1doy A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [54298] (3 PDB entries)

8. Domain d1doya_: 1doy A: [37669]
   complexed with fes

Details for d1doya_

PDB Entry: 1doy

PDB Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803

PDB Compounds: (A:) ferredoxin [2fe-2s]

SCOPe Domain Sequences for d1doya_:

Sequence; same for both SEQRES and ATOM records:

>d1doya_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

Timeline for d1doya_:

• d1doya_ first appeared (with stable ids) in SCOP 1.55, called d1doy__
  
• d1doya_ appears in SCOPe 2.07