SCOPe 2.07: Domain d6ir2a_: 6ir2 A:

Lineage for d6ir2a_ (6ir2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Anaplasma marginale [TaxId:770] [277056] (3 PDB entries)

8. Domain d6ir2a_: 6ir2 A: [376688]
   Other proteins in same PDB: d6ir2b_
   automated match to d3sv5a_

Details for d6ir2a_

PDB Entry: 6ir2, 1.39 Å

PDB Description: crystal structure of red fluorescent protein mcherry complexed with the nanobody lam2 at 1.4 angstron resolution

PDB Compounds: (A:) MCherry fluorescent protein

SCOPe Domain Sequences for d6ir2a_:

Sequence; same for both SEQRES and ATOM records:

>d6ir2a_ d.22.1.1 (A:) automated matches {Anaplasma marginale [TaxId: 770]}
maiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspq
fmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkl
rgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykak
kpvqlpgaynvniklditshnedytiveqyeraegrh

Timeline for d6ir2a_:

• d6ir2a_ is new in SCOPe 2.07-stable
  
• d6ir2a_ appears in the current release, SCOPe 2.08