Lineage for d6ir1a_ (6ir1 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein automated matches [190406] (19 species)
not a true protein
Species Anaplasma marginale [TaxId:770] [277056] (3 PDB entries) 
Domain d6ir1a_: 6ir1 A: [376685]
Other proteins in same PDB: d6ir1b_
automated match to d3srya_
Details for d6ir1a_
PDB Entry: 6ir1 (more details), 1.92 Å
PDB Description: crystal structure of red fluorescent protein mcherry complexed with the nanobody lam4 at 1.9 angstron resolution
PDB Compounds: (A:) MCherry fluorescent proteinSCOPe Domain Sequences for d6ir1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ir1a_ d.22.1.1 (A:) automated matches {Anaplasma marginale [TaxId: 770]}
aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykakk
pvqlpgaynvniklditshnedytiveqyeraegrhstg
SCOPe Domain Coordinates for d6ir1a_:
Click to download the PDB-style file with coordinates for d6ir1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ir1a_:
- d6ir1a_ first appeared in SCOPe 2.07
View in 3D
