Lineage for d1dox__ (1dox -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254175Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 254176Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 254177Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 254232Species Synechocystis sp., pcc 6803 [TaxId:1148] [54298] (2 PDB entries)
  8. 254233Domain d1dox__: 1dox - [37668]
    complexed with fes

Details for d1dox__

PDB Entry: 1dox (more details)

PDB Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803

SCOP Domain Sequences for d1dox__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dox__ d.15.4.1 (-) 2Fe-2S ferredoxin {Synechocystis sp., pcc 6803}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

SCOP Domain Coordinates for d1dox__:

Click to download the PDB-style file with coordinates for d1dox__.
(The format of our PDB-style files is described here.)

Timeline for d1dox__: