Lineage for d1dox__ (1dox -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) Protein 2Fe-2S ferredoxin [54294] (11 species) 
Species Synechocystis sp., pcc 6803 [TaxId:1148] [54298] (2 PDB entries) 
Domain d1dox__: 1dox - [37668]
Details for d1dox__
PDB Entry: 1dox (more details)
PDB Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
SCOP Domain Sequences for d1dox__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dox__ d.15.4.1 (-) 2Fe-2S ferredoxin {Synechocystis sp., pcc 6803}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly
SCOP Domain Coordinates for d1dox__:
Click to download the PDB-style file with coordinates for d1dox__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dox__:
- d1dox__ appears in SCOP 1.57
- d1dox__ appears in the current release, SCOPe 2.08, called d1doxa_
View in 3D