Lineage for d1doxa_ (1dox A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [54298] (3 PDB entries)
  8. Domain d1doxa_: 1dox A: [37668]
    complexed with fes

Details for d1doxa_

PDB Entry: 1dox (more details)

PDB Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
PDB Compounds: (A:) ferredoxin [2fe-2s]

SCOPe Domain Sequences for d1doxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doxa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

SCOPe Domain Coordinates for d1doxa_ are not available.

Timeline for d1doxa_: