Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (13 PDB entries) |
Domain d6eb7a_: 6eb7 A: [376678] automated match to d1nxoa_ complexed with bef, mn |
PDB Entry: 6eb7 (more details), 1.58 Å
SCOPe Domain Sequences for d6eb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eb7a_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr
Timeline for d6eb7a_: