Lineage for d6eb7a_ (6eb7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855544Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 2855545Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (13 PDB entries)
  8. 2855553Domain d6eb7a_: 6eb7 A: [376678]
    automated match to d1nxoa_
    complexed with bef, mn

Details for d6eb7a_

PDB Entry: 6eb7 (more details), 1.58 Å

PDB Description: yycf homologue (sp1227) receiver domain activated by bef3
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d6eb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eb7a_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr

SCOPe Domain Coordinates for d6eb7a_:

Click to download the PDB-style file with coordinates for d6eb7a_.
(The format of our PDB-style files is described here.)

Timeline for d6eb7a_: