Lineage for d6upha_ (6uph A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312074Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)
  8. 2312105Domain d6upha_: 6uph A: [376670]
    automated match to d2pyoa_

Details for d6upha_

PDB Entry: 6uph (more details), 2.7 Å

PDB Description: structure of a yeast centromeric nucleosome at 2.7 angstrom resolution
PDB Compounds: (A:) histone h3-like centromeric protein cse4

SCOPe Domain Sequences for d6upha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6upha_ a.22.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
elalyeirkyqrstdlliskipfarlvkevtdefttkdqdlrwqsmaimalqeaseaylv
gllehtnllalhakritimkkdmqlarrirgqf

SCOPe Domain Coordinates for d6upha_:

Click to download the PDB-style file with coordinates for d6upha_.
(The format of our PDB-style files is described here.)

Timeline for d6upha_: