Lineage for d6uphf_ (6uph F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312415Species Kluyveromyces lactis [TaxId:284590] [226140] (3 PDB entries)
  8. 2312428Domain d6uphf_: 6uph F: [376660]
    automated match to d4jjnf_

Details for d6uphf_

PDB Entry: 6uph (more details), 2.7 Å

PDB Description: structure of a yeast centromeric nucleosome at 2.7 angstrom resolution
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d6uphf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uphf_ a.22.1.1 (F:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
ldvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d6uphf_:

Click to download the PDB-style file with coordinates for d6uphf_.
(The format of our PDB-style files is described here.)

Timeline for d6uphf_: