![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (17 species) |
![]() | Species Cyanobacterium (Aphanothece sacrum) [TaxId:1122] [54297] (1 PDB entry) |
![]() | Domain d1fxia_: 1fxi A: [37664] |
PDB Entry: 1fxi (more details), 2.2 Å
SCOP Domain Sequences for d1fxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Aphanothece sacrum) [TaxId: 1122]} asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded qsfldddqiqagyiltcvayptgdcviethkeealy
Timeline for d1fxia_: