SCOP 1.75: Domain d1fxia_: 1fxi A:

Lineage for d1fxia_ (1fxi A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Cyanobacterium (Aphanothece sacrum) [TaxId:1122] [54297] (1 PDB entry)

8. Domain d1fxia_: 1fxi A: [37664]

Details for d1fxia_

PDB Entry: 1fxi, 2.2 Å

PDB Description: structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution

PDB Compounds: (A:) ferredoxin I

SCOP Domain Sequences for d1fxia_:

Sequence; same for both SEQRES and ATOM records:

>d1fxia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Aphanothece sacrum) [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

Timeline for d1fxia_:

• d1fxia_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxia_ appears in SCOP 1.73
  
• d1fxia_ appears in SCOPe 2.01
  
• d1fxia_ appears in the current release, SCOPe 2.08