Lineage for d1fxia_ (1fxi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933802Species Aphanothece sacrum [TaxId:1122] [54297] (1 PDB entry)
  8. 2933803Domain d1fxia_: 1fxi A: [37664]
    complexed with fes

Details for d1fxia_

PDB Entry: 1fxi (more details), 2.2 Å

PDB Description: structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1fxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

SCOPe Domain Coordinates for d1fxia_:

Click to download the PDB-style file with coordinates for d1fxia_.
(The format of our PDB-style files is described here.)

Timeline for d1fxia_: